PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g65660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 125aa    MW: 14613.1 Da    PI: 11.9812
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g65660genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA82.28.9e-262071355
   CBFB_NFYA  3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsg 55
                p+YVNaKQy++IlkRRq  ak ++++kl +k+rkpylh+SRh+hA++R Rg g
  CA00g65660 20 PIYVNAKQYSAILKRRQVHAKRQDQNKL-IKNRKPYLHKSRHRHAMKRSRGFG 71
                9***************************.**********************77 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.2E-261677IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115229.6241777IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-182042IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-212070IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-185174IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MVGVTTTRVA LPLECIEIFP IYVNAKQYSA ILKRRQVHAK RQDQNKLIKN RKPYLHKSRH  60
RHAMKRSRGF GECFLNTKNM RQSKPSSPKH DRNIFNRQAG VLALAIRDSL TIHPWILRGD  120
RRTW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-162079463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15867RHRHAMKRSR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8654091e-125KJ865409.1 Capsicum annuum cultivar CMS line FS4401 mitochondrion, complete genome.
GenBankKJ8654101e-125KJ865410.1 Capsicum annuum cultivar Jeju mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqYP_009049690.19e-57hypothetical protein (mitochondrion)
SwissprotQ9LNP68e-27NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLA0A075VW311e-56A0A075VW31_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000559829e-54(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48002027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.45e-28nuclear factor Y, subunit A8